PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011075514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 430aa    MW: 47595.9 Da    PI: 6.4282
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011075514.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.5e-39119178261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+l+cprC+st+tkfCyynny+++qPr+fCk+C+ryWt GG++rnvPvG+grrknk++
  XP_011075514.1 119 PDKILPCPRCNSTDTKFCYYNNYNVNQPRHFCKNCQRYWTSGGTMRNVPVGSGRRKNKNA 178
                     7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29116176IPR003851Zinc finger, Dof-type
PfamPF027017.0E-32121177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.956123177IPR003851Zinc finger, Dof-type
PROSITE patternPS013610125161IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MSEVVKRDCE IKLFGKTICL MPDKVVSDSK VPEDRQSSSA TSTSEDSKDV SEEELTGSKH  60
EHESINPTEE TLTEAATSSE ITDDPGTADL EKEPLSPETP KEEEPSESNA PQEKTLKKPD  120
KILPCPRCNS TDTKFCYYNN YNVNQPRHFC KNCQRYWTSG GTMRNVPVGS GRRKNKNAVV  180
PNYRHITFLD TLTRADAING SRLSSLKPNG FLVFGSDTQL CESMNCTLNL GERSQNCVPN  240
EFYEHSSISS TRTSNSTEKD GHAAMQESDL HISQNRMQWT SSKPPTTFGQ SGFPVTFYPA  300
TPYWGSAVTS PWNVPLVSST SSILGKHSRE ETMVRSSNLG KENLSEKVGR ERSVLVPKTL  360
RIDDPDEAAK SSIWSTLGIK KEKIGSINGK SLFKAFETKG DRNSNIDNTA VVLQANPAAL  420
CRSLNFHEST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075514.10.0PREDICTED: cyclic dof factor 1
SwissprotQ93ZL51e-76CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A068TWC91e-146A0A068TWC9_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00980.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-76cycling DOF factor 2